ASAH1 monoclonal antibody (M01), clone 2C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ASAH1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASAH1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ASAH1.
Immunogen
ASAH1 (NP_808592, 25 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (79)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ASAH1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASAH1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — ASAH1
Entrez GeneID
427GeneBank Accession#
NM_177924Protein Accession#
NP_808592Gene Name
ASAH1
Gene Alias
AC, ASAH, FLJ21558, FLJ22079, PHP, PHP32
Gene Description
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Omim ID
228000Gene Ontology
HyperlinkGene Summary
This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
N-acylsphingosine amidohydrolase 1|OTTHUMP00000122482|acylsphingosine deacylase|putative 32 kDa heart protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Ceramide biosynthesis and metabolism in trophoblast syncytialization.
Singh AT, Dharmarajan A, Aye IL, Keelan JA.
Molecular and Cellular Endocrinology 2012 Oct; 362(1-2):48.
Application：WB-Ce, Human, Human trophoblasts.
-
Ceramide biosynthesis and metabolism in trophoblast syncytialization.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com