ARVCF monoclonal antibody (M01), clone 5D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARVCF.
Immunogen
ARVCF (NP_001661, 863 a.a. ~ 962 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (77)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARVCF monoclonal antibody (M01), clone 5D2 Western Blot analysis of ARVCF expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ARVCF on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — ARVCF
Entrez GeneID
421GeneBank Accession#
NM_001670Protein Accession#
NP_001661Gene Name
ARVCF
Gene Alias
FLJ35345
Gene Description
armadillo repeat gene deletes in velocardiofacial syndrome
Omim ID
602269Gene Ontology
HyperlinkGene Summary
Armadillo Repeat gene deleted in Velo-Cardio-Facial syndrome (ARVCF) is a member of the catenin family which play an important role in the formation of adherens junction complexes, which are thought to facilitate communication between the inside and outside environments of a cell. ARVCF gene was isolated in the search for the genetic defect responsible for the autosomal dominant Velo-Cardio-Facial syndrome (VCFS) a relatively common human disorder with phenotypic features including cleft palate, conotruncal heart defects and facial dysmorphology. ARVCF gene encodes a protein containing two motifs, a coiled coil domain in the N-terminus and a 10 armadillo repeat sequence in the midregion. Since these sequences can facilitate protein-protein interactions ARVCF is thought to function in a protein complex. In addition, ARVCF contains a predicted nuclear-targeting sequence suggesting that it may have a function as a nuclear protein. [provided by RefSeq
Other Designations
armadillo repeat protein
-
Interactome
-
Disease
-
Publication Reference
-
p53-induced ARVCF modulates the splicing landscape and supports the tumor suppressive function of p53.
Suzuki N, Idogawa M, Tange S, Ohashi T, Sasaki Y, Nakase H, Tokino T.
Oncogene 2019 Dec; [Epub].
Application:WB-Ce, Human, A549, MCF-7, U2OS cells.
-
Xenopus Kazrin interacts with ARVCF-catenin, spectrin and p190B RhoGAP, and modulates RhoA activity and epithelial integrity.
Cho K, Vaught TG, Ji H, Gu D, Papasakelariou-Yared C, Horstmann N, Jennings JM, Lee M, Sevilla LM, Kloc M, Reynolds AB, Watt FM, Brennan RG, Kowalczyk AP, McCrea PD.
Journal of Cell Science 2010 Dec; 123(Pt 23):4128.
Application:IP, WB-Ce, WB-Ti, Human, Xenopus, Embryos, A431 cells.
-
p53-induced ARVCF modulates the splicing landscape and supports the tumor suppressive function of p53.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com