Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ART3 monoclonal antibody (M09), clone 1D2

  • Catalog # : H00000419-M09
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ART3.
  • Immunogen:
  • ART3 (NP_001170, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000419-M09
    Western Blot detection against Immunogen (37.84 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ART3 expression in transfected 293T cell line by ART3 monoclonal antibody (M09), clone 1D2.

    Lane 1: ART3 transfected lysate(42.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ART3 transfected lysate using anti-ART3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ART3 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 419
  • Gene Name:
  • ART3
  • Gene Alias:
  • FLJ26404
  • Gene Description:
  • ADP-ribosyltransferase 3
  • Gene Summary:
  • ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases, such as ART3, transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases (see PARG; MIM 603501) reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]).[supplied by OMIM
  • Other Designations:
  • mono-ADP-ribosyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook