Product Browser

Last updated: 2017/12/10
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STS polyclonal antibody (A01)

  • Catalog # : H00000412-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant STS.
  • Immunogen:
  • STS (NP_000342, 248 a.a. ~ 350 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000412-A01
    Western Blot detection against Immunogen (37.44 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 412
  • Gene Name:
  • STS
  • Gene Alias:
  • ARSC,ARSC1,ASC,ES,SSDD
  • Gene Description:
  • steroid sulfatase (microsomal), isozyme S
  • Gene Summary:
  • The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022868,arylsulfatase C,estrone sulfatase,steryl-sulfatase,steryl-sulfate sulfohydrolase
  • RSS
  • YouTube
  • Linkedin
  • Facebook