PHOX2A monoclonal antibody (M01), clone 4F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PHOX2A monoclonal antibody (M01), clone 4F6 Western Blot analysis of PHOX2A expression in PC-12 ( Cat # L012V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody (M01), clone 4F6.
Lane 1: PHOX2A transfected lysate(29.7 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi ( Cat # H00000401-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PHOX2A monoclonal antibody (M01), clone 4F6 (Cat # H00000401-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PHOX2A.
Immunogen
PHOX2A (NP_005160, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PHOX2A monoclonal antibody (M01), clone 4F6 Western Blot analysis of PHOX2A expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody (M01), clone 4F6.
Lane 1: PHOX2A transfected lysate(29.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi ( Cat # H00000401-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PHOX2A monoclonal antibody (M01), clone 4F6 (Cat # H00000401-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PHOX2A
Entrez GeneID
401GeneBank Accession#
NM_005169Protein Accession#
NP_005160Gene Name
PHOX2A
Gene Alias
ARIX, CFEOM2, FEOM2, MGC52227, NCAM2, PMX2A
Gene Description
paired-like homeobox 2a
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles. [provided by RefSeq
Other Designations
aristaless homeobox homolog|arix homeodomain protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com