Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RHOC (Human) Recombinant Protein (P01)

  • Catalog # : H00000389-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RHOC full-length ORF ( AAH07245, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 46.97
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000389-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 389
  • Gene Name:
  • RHOC
  • Gene Alias:
  • ARH9,ARHC,H9,MGC1448,MGC61427,RHOH9
  • Gene Description:
  • ras homolog gene family, member C
  • Gene Summary:
  • This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000013675,OTTHUMP00000013676,OTTHUMP00000013802,OTTHUMP00000013805,OTTHUMP00000013807,OTTHUMP00000013809,RAS-related homolog 9,Rho-related GTP-binding protein RhoC,oncogene RHO H9,rhoC GTPase,small GTP binding protein RhoC
  • RSS
  • YouTube
  • Linkedin
  • Facebook