RHOC polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RHOC.
Immunogen
RHOC (NP_786886, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Sequence
SLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — RHOC
Entrez GeneID
389GeneBank Accession#
NM_175744Protein Accession#
NP_786886Gene Name
RHOC
Gene Alias
ARH9, ARHC, H9, MGC1448, MGC61427, RHOH9
Gene Description
ras homolog gene family, member C
Omim ID
165380Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000013675|OTTHUMP00000013676|OTTHUMP00000013802|OTTHUMP00000013805|OTTHUMP00000013807|OTTHUMP00000013809|RAS-related homolog 9|Rho-related GTP-binding protein RhoC|oncogene RHO H9|rhoC GTPase|small GTP binding protein RhoC
-
Interactome
-
Disease
-
Publication Reference
-
RhoB/ROCK mediates oxygen-glucose deprivation-stimulated syncytiotrophoblast microparticle shedding in preeclampsia.
Han J, Yang BP, Li YL, Li HM, Zheng XH, Yu LL, Zhang Q, Zheng YR, Yi P, Li L, Guo JX, Zhou YG.
Cell and Tissue Research 2016 Jun; 366(2):411.
Application:WB, Human, Placenta tissue.
-
RhoB/ROCK mediates oxygen-glucose deprivation-stimulated syncytiotrophoblast microparticle shedding in preeclampsia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com