ARF1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human ARF1 full-length ORF ( AAH11358, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDVVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.65
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ARF1
Entrez GeneID
375GeneBank Accession#
BC011358Protein Accession#
AAH11358Gene Name
ARF1
Gene Alias
-
Gene Description
ADP-ribosylation factor 1
Omim ID
103180Gene Ontology
HyperlinkGene Summary
ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000035715
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Hepatitis B virus utilizes a retrograde trafficking route via the trans-Golgi network to avoid lysosomal degradation.
Ying-Yi Li, Kazuyuki Kuroki, Tetsuro Shimakami, Kazuhisa Murai, Kazunori Kawaguchi, Takayoshi Shirasaki, Kouki Nio, Saiho Sugimoto, Tomoki Nishikawa, Hikari Okada, Noriaki Orita, Hideo Takayama, Ying Wang, Phuong Doan Thi Bich, Astuya Ishida, Sadahiro Iwabuchi, Shinichi Hashimoto, Takeshi Shimaoka, Noriko Tabata, Miho Watanabe-Takahashi, Kiyotaka Nishikawa, Hiroshi Yanagawa, Motoharu Seiki, Kouji Matsushima, Taro Yamashita, Shuichi Kaneko, Masao Honda.
Cellular and Molecular Gastroenterology and Hepatology 2022 Oct; S2352-345X(22):219.
Application：Func, Recombinant proteins.
-
Hepatitis B virus utilizes a retrograde trafficking route via the trans-Golgi network to avoid lysosomal degradation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com