Product Browser

Last updated: 2017/3/19
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ABCC6 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00000368-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ABCC6 protein.
  • Immunogen:
  • ABCC6 (NP_001072996.1, 1 a.a. ~ 99 a.a) full-length human protein.
  • Sequence:
  • MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPGSLEPGNVRGRQGTGWNLVKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ABCC6 expression in transfected 293T cell line (H00000368-T01) by ABCC6 MaxPab polyclonal antibody.

    Lane 1: ABCC6 transfected lysate(10.89 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 368
  • Gene Name:
  • ABCC6
  • Gene Alias:
  • ABC34,ARA,EST349056,MLP1,MOATE,MRP6,PXE,PXE1
  • Gene Description:
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 6
  • Gene Summary:
  • The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq
  • Other Designations:
  • ATP-binding cassette, sub-family C, member 6,anthracycline resistance-associated
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook