APRT MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human APRT protein.
Immunogen
APRT (NP_000476.1, 1 a.a. ~ 180 a.a) full-length human protein.
Sequence
MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
APRT MaxPab rabbit polyclonal antibody. Western Blot analysis of APRT expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of APRT expression in transfected 293T cell line (H00000353-T01) by APRT MaxPab polyclonal antibody.
Lane 1: APRT transfected lysate(19.60 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of APRT transfected lysate using anti-APRT MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with APRT purified MaxPab mouse polyclonal antibody (B01P) (H00000353-B01P). -
Gene Info — APRT
Entrez GeneID
353GeneBank Accession#
NM_000485.2Protein Accession#
NP_000476.1Gene Name
APRT
Gene Alias
AMP, DKFZp686D13177, MGC125856, MGC125857, MGC129961
Gene Description
adenine phosphoribosyltransferase
Omim ID
102600Gene Ontology
HyperlinkGene Summary
Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
AMP diphosphorylase|AMP pyrophosphorylase|adenine phosphoribosyltransferase, isoform a|transphosphoribosidase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com