APOH MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
APOH MaxPab polyclonal antibody. Western Blot analysis of APOH expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of APOH expression in transfected 293T cell line (H00000350-T01) by APOH MaxPab polyclonal antibody.
Lane 1: APOH transfected lysate(37.95 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human APOH protein.
Immunogen
APOH (AAH26283.1, 1 a.a. ~ 345 a.a) full-length human protein.
Sequence
MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
APOH MaxPab polyclonal antibody. Western Blot analysis of APOH expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of APOH expression in transfected 293T cell line (H00000350-T01) by APOH MaxPab polyclonal antibody.
Lane 1: APOH transfected lysate(37.95 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — APOH
Entrez GeneID
350GeneBank Accession#
BC026283Protein Accession#
AAH26283.1Gene Name
APOH
Gene Alias
B2G1, BG
Gene Description
apolipoprotein H (beta-2-glycoprotein I)
Omim ID
138700Gene Ontology
HyperlinkGene Summary
Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq
Other Designations
apolipoprotein H|beta-2-glycoprotein I
-
Interactome
-
Disease
-
Publication Reference
-
Antiphospholipid antibodies induce a pro-inflammatory response in first trimester trophoblast via the TLR4/MyD88 pathway.
Mulla MJ, Brosens JJ, Chamley LW, Giles I, Pericleous C, Rahman A, Joyce SK, Panda B, Paidas MJ, Abrahams VM.
American Journal of Reproductive Immunology 2009 Aug; 62(2):96.
Application：WB, Human, HTR8 cells.
-
Antiphospholipid antibodies induce a pro-inflammatory response in first trimester trophoblast via the TLR4/MyD88 pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com