APOC4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
APOC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOC4 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of APOC4 expression in transfected 293T cell line (H00000346-T01) by APOC4 MaxPab polyclonal antibody.
Lane 1: APOC4 transfected lysate(14.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human APOC4 protein.
Immunogen
APOC4 (NP_001637.1, 1 a.a. ~ 127 a.a) full-length human protein.
Sequence
MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Host
Rabbit
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
APOC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOC4 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of APOC4 expression in transfected 293T cell line (H00000346-T01) by APOC4 MaxPab polyclonal antibody.
Lane 1: APOC4 transfected lysate(14.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — APOC4
Entrez GeneID
346GeneBank Accession#
NM_001646.1Protein Accession#
NP_001637.1Gene Name
APOC4
Gene Alias
-
Gene Description
apolipoprotein C-IV
Omim ID
600745Gene Ontology
HyperlinkGene Summary
Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3-kb gene consisting of 3 exons and 2 introns; it is located 0.5 kb 5' to the APOC2 gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com