APOC3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human APOC3 partial ORF ( NP_000031.1, 21 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.43
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — APOC3
Entrez GeneID
345GeneBank Accession#
NM_000040Protein Accession#
NP_000031.1Gene Name
APOC3
Gene Alias
APOCIII, MGC150353
Gene Description
apolipoprotein C-III
Omim ID
107720Gene Ontology
HyperlinkGene Summary
Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Dysfunctional high-density lipoproteins have distinct composition, diminished anti-inflammatory potential and discriminate acute coronary syndrome from stable coronary artery disease patients.
Mihaela G Carnuta, Camelia S Stancu, Laura Toma, Gabriela M Sanda, Loredan S Niculescu, Mariana Deleanu, Andreea C Popescu, Mihaela R Popescu, Adelina Vlad, Doina R Dimulescu, Maya Simionescu, Anca V Sima.
Scientific Reports 2017 Aug; 7(1):7295.
Application:Quant, Human, Serum.
-
Apolipoprotein A-IV is a candidate target molecule for the treatment of seasonal allergic rhinitis.
Makino Y, Noguchi E, Takahashi N, Matsumoto Y, Kubo S, Yamada T, Imoto Y, Ito Y, Osawa Y, Shibasaki M, Uchida K, Meno K, Suzuki H, Okubo K, Arinami T, Fujieda S.
The Journal of Allergy and Clinical Immunology 2010 Dec; 126(6):1163.
Application:Func, Human, Human basophils.
-
Dysfunctional high-density lipoproteins have distinct composition, diminished anti-inflammatory potential and discriminate acute coronary syndrome from stable coronary artery disease patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com