APOC1 monoclonal antibody (M01), clone 2E2-1A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant APOC1.
Immunogen
APOC1 (AAH09698, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
APOC1 monoclonal antibody (M01), clone 2E2-1A3. Western Blot analysis of APOC1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of APOC1 expression in transfected 293T cell line by APOC1 monoclonal antibody (M01), clone 2E2-1A3.
Lane 1: APOC1 transfected lysate(9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — APOC1
Entrez GeneID
341GeneBank Accession#
BC009698Protein Accession#
AAH09698Gene Name
APOC1
Gene Alias
-
Gene Description
apolipoprotein C-I
Omim ID
107710Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Amphipathic α-Helices in Apolipoproteins Are Crucial to the Formation of Infectious Hepatitis C Virus Particles.
Fukuhara T, Wada M, Nakamura S, Ono C, Shiokawa M, Yamamoto S, Motomura T, Okamoto T, Okuzaki D, Yamamoto M, Saito I, Wakita T, Koike K, Matsuura Y.
PLoS Pathogens 2014 Dec; 10(12):e1004534.
Application:WB-Tr, Human, Huh7, Huh7-ApoA1, Huh7-ApoA2, Huh7-ApoC1, Huh7-ApoE, Huh7-ApoH, BE-KO1, BE-KO1-ApoA1, BE-KO1-ApoA2, BE-KO1-ApoC1, BE-KO1-ApoE, BE-KO1-ApoH, 293T cells.
-
Proteins related to lipoprotein profile were identified using a pharmaco-proteomic approach as markers for growth response to growth hormone (GH) treatment in short prepubertal children.
Andersson B, Hellgren G, Nierop AF, Hochberg Z, Albertsson-Wikland K.
Proteome Science 2009 Nov; 7:40.
Application:Func, Human, Human serum.
-
Apolipoprotein C1 association with Hepatitis C Virus.
Meunier JC, Russell RS, Engle RH, Faulk KN, Purcell RH, Emerson SU.
Journal of Virology 2008 Jul; 82(19):9647.
Application:Flow Cyt, Human, Huh7 cells.
-
Amphipathic α-Helices in Apolipoproteins Are Crucial to the Formation of Infectious Hepatitis C Virus Particles.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com