Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APOA2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000336-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human APOA2 protein.
  • Immunogen:
  • APOA2 (NP_001634.1, 1 a.a. ~ 100 a.a) full-length human protein.
  • Sequence:
  • MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of APOA2 expression in transfected 293T cell line (H00000336-T02) by APOA2 MaxPab polyclonal antibody.

    Lane 1: APOA2 transfected lysate(11.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 336
  • Gene Name:
  • APOA2
  • Gene Alias:
  • -
  • Gene Description:
  • apolipoprotein A-II
  • Gene Summary:
  • This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032244
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook