APCS polyclonal antibody (A02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
APCS polyclonal antibody (A02), Lot # 051011JC01. Western Blot analysis of APCS expression in human ovarian cancer.
Western Blot detection against Immunogen (37.88 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant APCS.
Immunogen
APCS (NP_001630, 117 a.a. ~ 223 a.a) partial recombinant protein with GST tag.
Sequence
WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (73)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.88 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
APCS polyclonal antibody (A02), Lot # 051011JC01. Western Blot analysis of APCS expression in human ovarian cancer.Western Blot (Recombinant protein)
ELISA
-
Gene Info — APCS
Entrez GeneID
325GeneBank Accession#
NM_001639Protein Accession#
NP_001630Gene Name
APCS
Gene Alias
MGC88159, PTX2, SAP
Gene Description
amyloid P component, serum
Omim ID
104770Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. [provided by RefSeq
Other Designations
9.5S alpha-1-glycoprotein|OTTHUMP00000024355|pentaxin-related|serum amyloid P component
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com