Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APBA2 (Human) Recombinant Protein (P01)

  • Catalog # : H00000321-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human APBA2 full-length ORF (BAC85951.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAVIPESAWKHPDYVDDGLSGVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKNSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDVSKPLPGHSPPKVHSPGRLQDPGAVETTLRWKASMLLLMFPVDQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 53.24
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 321
  • Gene Name:
  • APBA2
  • Gene Alias:
  • D15S1518E,HsT16821,LIN-10,MGC99508,MGC:14091,MINT2,X11L
  • Gene Description:
  • amyloid beta (A4) precursor protein-binding, family A, member 2
  • Gene Summary:
  • The protein encoded by this gene is a member of the X11 protein family. It is a neuronal adapter protein that interacts with the Alzheimer's disease amyloid precursor protein (APP). It stabilizes APP and inhibits production of proteolytic APP fragments including the A beta peptide that is deposited in the brains of Alzheimer's disease patients. This gene product is believed to be involved in signal transduction processes. It is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • X11-like protein,adapter protein X11beta,amyloid beta (A4) precursor protein-binding, family A, member 2 (X11-like),amyloid beta A4 precursor protein-binding, family A, member 2,neuron-specific X11L protein,neuronal munc18-1-interacting protein 2,phosphot
  • RSS
  • YouTube
  • Linkedin
  • Facebook