APBA2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human APBA2 full-length ORF (BAC85951.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAVIPESAWKHPDYVDDGLSGVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKNSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDVSKPLPGHSPPKVHSPGRLQDPGAVETTLRWKASMLLLMFPVDQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
53.24
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — APBA2
Entrez GeneID
321GeneBank Accession#
AK124794.1Protein Accession#
BAC85951.1Gene Name
APBA2
Gene Alias
D15S1518E, HsT16821, LIN-10, MGC99508, MGC:14091, MINT2, X11L
Gene Description
amyloid beta (A4) precursor protein-binding, family A, member 2
Omim ID
602712Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the X11 protein family. It is a neuronal adapter protein that interacts with the Alzheimer's disease amyloid precursor protein (APP). It stabilizes APP and inhibits production of proteolytic APP fragments including the A beta peptide that is deposited in the brains of Alzheimer's disease patients. This gene product is believed to be involved in signal transduction processes. It is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
X11-like protein|adapter protein X11beta|amyloid beta (A4) precursor protein-binding, family A, member 2 (X11-like)|amyloid beta A4 precursor protein-binding, family A, member 2|neuron-specific X11L protein|neuronal munc18-1-interacting protein 2|phosphot
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com