NUDT2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NUDT2 protein.
Immunogen
NUDT2 (NP_001152.1, 1 a.a. ~ 147 a.a) full-length human protein.
Sequence
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NUDT2 MaxPab polyclonal antibody. Western Blot analysis of NUDT2 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of NUDT2 expression in transfected 293T cell line (H00000318-T01) by NUDT2 MaxPab polyclonal antibody.
Lane 1: NUDT2 transfected lysate(16.17 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NUDT2
Entrez GeneID
318GeneBank Accession#
NM_001161Protein Accession#
NP_001152.1Gene Name
NUDT2
Gene Alias
APAH1, MGC10404
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 2
Omim ID
602852Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. [provided by RefSeq
Other Designations
Ap4A hydrolase 1|Ap4Aase|OTTHUMP00000021256|OTTHUMP00000021257|OTTHUMP00000021258|OTTHUMP00000021259|bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)|diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase|diadenosine tetraphosphatase|nudix-type mot
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com