ANXA4 monoclonal antibody (M13), clone 1D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ANXA4 expression in transfected 293T cell line by ANXA4 monoclonal antibody (M13), clone 1D3.
Lane 1: ANXA4 transfected lysate(36.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ANXA4 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (61.05 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ANXA4.
Immunogen
ANXA4 (AAH00182, 1 a.a. ~ 321 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.05 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ANXA4 expression in transfected 293T cell line by ANXA4 monoclonal antibody (M13), clone 1D3.
Lane 1: ANXA4 transfected lysate(36.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ANXA4 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — ANXA4
Entrez GeneID
307GeneBank Accession#
BC000182Protein Accession#
AAH00182Gene Name
ANXA4
Gene Alias
ANX4, DKFZp686H02120, MGC75105, PIG28, ZAP36
Gene Description
annexin A4
Omim ID
106491Gene Ontology
HyperlinkGene Summary
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq
Other Designations
annexin IV|annexin IV (placental anticoagulant protein II)|placental anticoagulant protein II|proliferation-inducing gene 28|proliferation-inducing protein 28
-
Interactome
-
Disease
-
Publication Reference
-
Proteomic analysis of the sheep caruncular and intercaruncular endometrium reveals changes.
Al-Gubory KH, Arianmanesh M, Garrel C, Bhattacharya S, Cash P, Fowler PA.
Reproduction 2014 Apr; 147(5):599.
Application：WB-Ti, Sheep, Caruncular endometrial tissues.
-
Annexin A4 is a possible biomarker for cisplatin susceptibility of malignant mesothelioma cells.
Yamashita T, Nagano K, Kanasaki S, Maeda Y, Furuya T, Inoue M, Nabeshi H, Yoshikawa T, Yoshioka Y, Itoh N, Abe Y, Kamada H, Tsutsumi Y, Tsunoda S.
Biochemical and Biophysical Research Communications 2012 Apr; 421(1):140.
Application：IHC-P, WB-Ce, WB-tr, Human, HMC, H28, H2052, H2452, H226, MSTO-221H cells, Mesothelial tissue.
-
Proteomic analysis of the sheep caruncular and intercaruncular endometrium reveals changes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com