ANXA4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ANXA4 protein.
Immunogen
ANXA4 (NP_001144.1, 1 a.a. ~ 321 a.a) full-length human protein.
Sequence
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Host
Rabbit
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in rat brain.Western Blot (Tissue lysate)
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse brain.Western Blot (Tissue lysate)
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in human stomach.Western Blot (Tissue lysate)
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse intestine.Western Blot (Cell lysate)
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in PC-12.Western Blot (Cell lysate)
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in K-562.Western Blot (Cell lysate)
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in A-431.Western Blot (Cell lysate)
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of ANXA4 expression in transfected 293T cell line (H00000307-T02) by ANXA4 MaxPab polyclonal antibody.
Lane 1: ANXA4 transfected lysate(36.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ANXA4
Entrez GeneID
307GeneBank Accession#
NM_001153.2Protein Accession#
NP_001144.1Gene Name
ANXA4
Gene Alias
ANX4, DKFZp686H02120, MGC75105, PIG28, ZAP36
Gene Description
annexin A4
Omim ID
106491Gene Ontology
HyperlinkGene Summary
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq
Other Designations
annexin IV|annexin IV (placental anticoagulant protein II)|placental anticoagulant protein II|proliferation-inducing gene 28|proliferation-inducing protein 28
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com