ANXA1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ANXA1 partial ORF ( AAH01275, 237 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
FQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ANXA1
Entrez GeneID
301GeneBank Accession#
BC001275Protein Accession#
AAH01275Gene Name
ANXA1
Gene Alias
ANX1, LPC1
Gene Description
annexin A1
Omim ID
151690Gene Ontology
HyperlinkGene Summary
Annexin I belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity. [provided by RefSeq
Other Designations
OTTHUMP00000021474|OTTHUMP00000021475|annexin I|annexin I (lipocortin I)|lipocortin I
-
Interactome
-
Disease
-
Publication Reference
-
Factor Xa binding to annexin 2 mediates signal transduction via protease-activated receptor 1.
Bhattacharjee G, Ahamed J, Pawlinski R, Liu C, Mackman N, Ruf W, Edgington TS.
Circulation Research 2008 Jan; 102(4):457.
Application:PI, Human, HUVEC.
-
Factor Xa binding to annexin 2 mediates signal transduction via protease-activated receptor 1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com