AMY1C purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
AMY1C MaxPab rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in human pancreas.
Western Blot (Cell lysate)
AMY1C MaxPab rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of AMY1C expression in transfected 293T cell line (H00000278-T01) by AMY1C MaxPab polyclonal antibody.
Lane 1: AMY1C transfected lysate(56.21 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human AMY1C protein.
Immunogen
AMY1C (AAI56581.1, 1 a.a. ~ 511 a.a) full-length human protein.
Sequence
MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
AMY1C MaxPab rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in human pancreas.Western Blot (Cell lysate)
AMY1C MaxPab rabbit polyclonal antibody. Western Blot analysis of AMY1C expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of AMY1C expression in transfected 293T cell line (H00000278-T01) by AMY1C MaxPab polyclonal antibody.
Lane 1: AMY1C transfected lysate(56.21 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AMY1C
Entrez GeneID
278GeneBank Accession#
BC156580.1Protein Accession#
AAI56581.1Gene Name
AMY1C
Gene Alias
AMY1
Gene Description
amylase, alpha 1C (salivary)
Omim ID
104702Gene Ontology
HyperlinkGene Summary
Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. [provided by RefSeq
Other Designations
1,4-alpha-D-glucan glucanohydrolase|OTTHUMP00000012722|amylase, salivary, alpha-1C|glycogenase|salivary amylase alpha 1C
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com