Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AMY1A (Human) Recombinant Protein (Q01)

  • Catalog # : H00000276-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AMY1A partial ORF ( NP_001008222, 172 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.88
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000276-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 276
  • Gene Name:
  • AMY1A
  • Gene Alias:
  • AMY1,AMY1B
  • Gene Description:
  • amylase, alpha 1A (salivary)
  • Gene Summary:
  • Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
  • Other Designations:
  • 1,4-alpha-D-glucan glucanohydrolase,OTTHUMP00000012688,alpha-amylase,amylase, salivary, alpha-1A,glycogenase,salivary amylase alpha 1A
  • RSS
  • YouTube
  • Linkedin
  • Facebook