AMPD2 monoclonal antibody (M01), clone 2F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
AMPD2 monoclonal antibody (M01), clone 2F5 Western Blot analysis of AMPD2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M01), clone 2F5.
Lane 1: AMPD2 transfected lysate(92.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AMPD2 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AMPD2.
Immunogen
AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AMPD2 monoclonal antibody (M01), clone 2F5 Western Blot analysis of AMPD2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M01), clone 2F5.
Lane 1: AMPD2 transfected lysate(92.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AMPD2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — AMPD2
Entrez GeneID
271GeneBank Accession#
NM_139156Protein Accession#
NP_631895Gene Name
AMPD2
Gene Alias
-
Gene Description
adenosine monophosphate deaminase 2 (isoform L)
Omim ID
102771Gene Ontology
HyperlinkGene Summary
Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle.[supplied by OMIM
Other Designations
AMP deaminase 2|OTTHUMP00000013369|OTTHUMP00000013371
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com