ALPI monoclonal antibody (M03), clone 3A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ALPI.
Immunogen
ALPI (NP_001622, 74 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ALPI monoclonal antibody (M03), clone 3A8 Western Blot analysis of ALPI expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALPI is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ALPI
Entrez GeneID
248GeneBank Accession#
NM_001631Protein Accession#
NP_001622Gene Name
ALPI
Gene Alias
IAP
Gene Description
alkaline phosphatase, intestinal
Omim ID
171740Gene Ontology
HyperlinkGene Summary
There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is upregulated during small intestinal epithelial cell differentiation. [provided by RefSeq
Other Designations
Kasahara isozyme|alkaline phosphomonoesterase|glycerophosphatase|intestinal alkaline phosphatase
-
Interactome
-
Pathway
-
Publication Reference
-
Roles of plasminogen in the alterations in bone marrow hematopoietic stem cells during bone repair.
Okada K, Kawao N, Tatsumi K, Ishida M, Takafuji Y, Kurashimo S, Okumoto K, Kojima K, Matsuo O, Kaji H.
Bone Reports 2018 Apr; 8:195.
Application:IF, Mouse, Bone.
-
Development of a fluorescence-based assay for drug interactions with human Multidrug Resistance Related Protein (MRP2; ABCC2) in MDCKII-MRP2 membrane vesicles.
Lechner C, Reichel V, Moenning U, Reichel A, Fricker G.
European Journal of Pharmaceutics and Biopharmaceutics 2010 Jun; 75(2):284.
Application:WB-Ce, Dog, MDCK II cells.
-
Roles of plasminogen in the alterations in bone marrow hematopoietic stem cells during bone repair.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com