Product Browser

Last updated: 2017/8/13
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALOX5AP (Human) Recombinant Protein (P01)

  • Catalog # : H00000241-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ALOX5AP full-length ORF ( AAH18538, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.45
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000241-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 241
  • Gene Name:
  • ALOX5AP
  • Gene Alias:
  • FLAP
  • Gene Description:
  • arachidonate 5-lipoxygenase-activating protein
  • Gene Summary:
  • This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. [provided by RefSeq
  • Other Designations:
  • MK-886-binding protein,OTTHUMP00000018204,five-lipoxygenase activating protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook