Product Browser

Last updated: 2017/6/18
  • Related Product Showcase
  • By Research Area

  • By Biomarker

  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKR1B1 polyclonal antibody (A01)

  • Catalog # : H00000231-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AKR1B1.
  • Immunogen:
  • AKR1B1 (AAH10391, 217 a.a. ~ 316 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000231-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 231
  • Gene Name:
  • AKR1B1
  • Gene Alias:
  • ADR,ALDR1,ALR2,AR,MGC1804
  • Gene Description:
  • aldo-keto reductase family 1, member B1 (aldose reductase)
  • Gene Summary:
  • This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq
  • Other Designations:
  • Lii5-2 CTCL tumor antigen,aldehyde reductase 1,aldo-keto reductase family 1, member B1,aldose reductase,low Km aldose reductase
  • RSS
  • YouTube
  • Linkedin
  • Facebook