Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALDH9A1 polyclonal antibody (A01)

  • Catalog # : H00000223-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ALDH9A1.
  • Immunogen:
  • ALDH9A1 (NP_000687, 173 a.a. ~ 270 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000223-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ALDH9A1 polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of ALDH9A1 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 223
  • Gene Name:
  • ALDH9A1
  • Gene Alias:
  • ALDH4,ALDH7,ALDH9,E3,TMABADH
  • Gene Description:
  • aldehyde dehydrogenase 9 family, member A1
  • Gene Summary:
  • This protein belongs to the aldehyde dehydrogenase family of proteins. It has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. The enzyme catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid (GABA). This isozyme is a tetramer of identical 54-kD subunits. [provided by RefSeq
  • Other Designations:
  • 4-trimethylaminobutyraldehyde dehydrogenase,OTTHUMP00000032604,R-aminobutyraldehyde dehydrogenase,aldehyde dehydrogenase (NAD+),aldehyde dehydrogenase 9A1,aldehyde dehydrogenase E3 isozyme,gamma-aminobutyraldehyde dehydrogenase
  • RSS
  • YouTube
  • Linkedin
  • Facebook