ALDH2 monoclonal antibody (M01), clone 1E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ALDH2 monoclonal antibody (M01), clone 1E5 Western Blot analysis of ALDH2 expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ALDH2 expression in transfected 293T cell line by ALDH2 monoclonal antibody (M01), clone 1E5.
Lane 1: ALDH2 transfected lysate(56.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALDH2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ALDH2.
Immunogen
ALDH2 (AAH02967, 408 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ALDH2 monoclonal antibody (M01), clone 1E5 Western Blot analysis of ALDH2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ALDH2 expression in transfected 293T cell line by ALDH2 monoclonal antibody (M01), clone 1E5.
Lane 1: ALDH2 transfected lysate(56.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALDH2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — ALDH2
Entrez GeneID
217GeneBank Accession#
BC002967Protein Accession#
AAH02967Gene Name
ALDH2
Gene Alias
ALDH-E2, ALDHI, ALDM, MGC1806
Gene Description
aldehyde dehydrogenase 2 family (mitochondrial)
Omim ID
100650Gene Ontology
HyperlinkGene Summary
This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. [provided by RefSeq
Other Designations
ALDH class 2|acetaldehyde dehydrogenase 2|liver mitochondrial ALDH|mitochondrial aldehyde dehydrogenase 2|nucleus-encoded mitochondrial aldehyde dehydrogenase 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Laser Microdissection and Two-Dimensional Difference Gel Electrophoresis Reveal the Role of a Novel Macrophage-Capping Protein in Lymph Node Metastasis in Gastric Cancer.
Ichikawa H, Kanda T, Kosugi SI, Kawachi Y, Sasaki H, Wakai T, Kondo T.
Journal of Proteome Research 2013 Aug; 12(8):3780.
Application：WB-Ti, Human, Gastric cancer.
-
Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.
Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK.
PLoS Computational Biology 2011 Jun; 7(6):e1002093.
Application：WB-Ce, Human, 143B TK- osteosarcoma cells.
-
Genome-wide identification and characterization of transcripts translationally regulated by bacterial lipopolysaccharide in macrophage-like J774.1 cells.
Hiroshi Kitamura, Masatoshi Ito, Tomoko Yuasa, Chisato Kikuguchi, Atsushi Hijikata, Michiyo Takayama, Yayoi Kimura, Ryo Yokoyama, Tomohiro Kaji, Osamu Ohara.
Physiological Genomics 2008 Mar; 33(1):121.
Application：WB-Ce, Mouse, Mouse macrophage-like J774.1 cells.
-
Laser Microdissection and Two-Dimensional Difference Gel Electrophoresis Reveal the Role of a Novel Macrophage-Capping Protein in Lymph Node Metastasis in Gastric Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com