ALAS2 monoclonal antibody (M01), clone 6C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ALAS2 monoclonal antibody (M01), clone 6C1. Western Blot analysis of ALAS2 expression in Raw 264.7.
Western Blot (Transfected lysate)
Western Blot analysis of ALAS2 expression in transfected 293T cell line by ALAS2 monoclonal antibody (M01), clone 6C1.
Lane 1: ALAS2 transfected lysate(64 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALAS2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ALAS2.
Immunogen
ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ALAS2 monoclonal antibody (M01), clone 6C1. Western Blot analysis of ALAS2 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of ALAS2 expression in transfected 293T cell line by ALAS2 monoclonal antibody (M01), clone 6C1.
Lane 1: ALAS2 transfected lysate(64 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALAS2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ALAS2
Entrez GeneID
212GeneBank Accession#
NM_000032Protein Accession#
NP_000023Gene Name
ALAS2
Gene Alias
ALAS-E, ALASE, ANH1, ASB, FLJ93603, XLSA
Gene Description
aminolevulinate, delta-, synthase 2
Omim ID
301300Gene Ontology
HyperlinkGene Summary
The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
5-aminolevulinate synthase, erythroid-specific, mitochondrial|5-aminolevulinic acid synthase|OTTHUMP00000023388|OTTHUMP00000023389|delta-ALA synthetase|delta-aminolevulinate synthase
-
Interactome
-
Pathway
-
Publication Reference
-
Sideroflexin 4 affects Fe-S cluster biogenesis, iron metabolism, mitochondrial respiration and heme biosynthetic enzymes.
Paul BT, Tesfay L, Winkler CR, Torti FM, Torti SV.
Scientific Reports 2019 Dec; 9(1):19634.
Application：WB-Tr, Human, K-562 cells.
-
Emodin can induce K562 cells to erythroid differentiation and improve the expression of globin genes.
Ma YN, Chen MT, Wu ZK, Zhao HL, Yu HC, Yu J, Zhang JW.
Molecular and Cellular Biochemistry 2013 Oct; 382(1-2):127.
Application：WB-Ce, Human, K562 cells.
-
Hypoxic Induction of Human Erythroid-Specific Delta-Aminolevulinate Synthase Mediated by Hypoxia-Inducible Factor 1.
Zhang FL, Shen GM, Liu XL, Wang F, Zhao HL, Yu J, Zhang JW.
Biochemistry 2011 Feb; 50(7):1194.
Application：WB, Human, K562 cells.
-
Sideroflexin 4 affects Fe-S cluster biogenesis, iron metabolism, mitochondrial respiration and heme biosynthetic enzymes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com