Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALAS2 polyclonal antibody (A01)

  • Catalog # : H00000212-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ALAS2.
  • Immunogen:
  • ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000212-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 212
  • Gene Name:
  • ALAS2
  • Gene Alias:
  • ALAS-E,ALASE,ANH1,ASB,FLJ93603,XLSA
  • Gene Description:
  • aminolevulinate, delta-, synthase 2
  • Gene Summary:
  • The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • 5-aminolevulinate synthase, erythroid-specific, mitochondrial,5-aminolevulinic acid synthase,OTTHUMP00000023388,OTTHUMP00000023389,delta-ALA synthetase,delta-aminolevulinate synthase
  • RSS
  • YouTube
  • Linkedin
  • Facebook