Product Browser

Last updated: 2017/10/22
  • Related Product Showcase
  • By Hot Target

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AK2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000204-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AK2 partial ORF ( NP_001616.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000204-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 204
  • Gene Name:
  • AK2
  • Gene Alias:
  • ADK2
  • Gene Description:
  • adenylate kinase 2
  • Gene Summary:
  • Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • ATP-AMP transphosphorylase,OTTHUMP00000004287,OTTHUMP00000004288,adenylate kinase isoenzyme 2, mitochondrial,adenylate kinase, mitochondrial
  • RSS
  • YouTube
  • Linkedin
  • Facebook