AK1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human AK1 protein.
Immunogen
AK1 (NP_000467.1, 1 a.a. ~ 194 a.a) full-length human protein.
Sequence
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of AK1 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of AK1 expression in transfected 293T cell line (H00000203-T01) by AK1 MaxPab polyclonal antibody.
Lane 1: AK1 transfected lysate(21.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AK1
Entrez GeneID
203GeneBank Accession#
NM_000476.1Protein Accession#
NP_000467.1Gene Name
AK1
Gene Alias
-
Gene Description
adenylate kinase 1
Omim ID
103000Gene Ontology
HyperlinkGene Summary
Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. [provided by RefSeq
Other Designations
ATP-AMP transphosphorylase|OTTHUMP00000022217|OTTHUMP00000022218|myokinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com