Product Browser

Last updated: 2017/1/22
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AIF1 (Human) Recombinant Protein (P01)

  • Catalog # : H00000199-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AIF1 full-length ORF ( AAH09474.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.91
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000199-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 199
  • Gene Name:
  • AIF1
  • Gene Alias:
  • AIF-1,IBA1,IRT-1
  • Gene Description:
  • allograft inflammatory factor 1
  • Gene Summary:
  • This gene is induced by cytokines and interferon. Its protein product is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029354,OTTHUMP00000029356,interferon gamma responsive transcript,ionized calcium-binding adapter molecule
  • RSS
  • YouTube
  • Linkedin
  • Facebook