AIF1 monoclonal antibody (M01), clone 2A2-B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant AIF1.
Immunogen
AIF1 (AAH09474.1, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (89)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.91 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AIF1 monoclonal antibody (M01), clone 2A2-B6 Western Blot analysis of AIF1 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AIF1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — AIF1
Entrez GeneID
199GeneBank Accession#
BC009474Protein Accession#
AAH09474.1Gene Name
AIF1
Gene Alias
AIF-1, IBA1, IRT-1
Gene Description
allograft inflammatory factor 1
Omim ID
601833Gene Ontology
HyperlinkGene Summary
This gene is induced by cytokines and interferon. Its protein product is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000029354|OTTHUMP00000029356|interferon gamma responsive transcript|ionized calcium-binding adapter molecule
-
Interactome
-
Disease
-
Publication Reference
-
Allograft inflammatory factor-1/Ionized calcium-binding adapter molecule 1 is specifically expressed by most subpopulations of macrophages and spermatids in testis.
Kohler C.
Cell and Tissue Research 2007 Sep; 330(2):291.
-
Allograft inflammatory factor-1/Ionized calcium-binding adapter molecule 1 is specifically expressed by most subpopulations of macrophages and spermatids in testis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com