Product Browser

Last updated: 2017/6/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NR0B1 polyclonal antibody (A01)

  • Catalog # : H00000190-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NR0B1.
  • Immunogen:
  • NR0B1 (NP_000466, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000190-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 190
  • Gene Name:
  • NR0B1
  • Gene Alias:
  • AHC,AHCH,AHX,DAX-1,DAX1,DSS,GTD,HHG,NROB1
  • Gene Description:
  • nuclear receptor subfamily 0, group B, member 1
  • Gene Summary:
  • This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023102,gonadotropin deficiency,nuclear hormone receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook