Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AGER (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00000177-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified AGER (AAH20669.1 23 a.a. - 342 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • AQNITARIGEPLVLKCKGAPKKPPQRLEWNLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 40.48
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-AGER plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    Western Blot
    QC Testing of H00000177-H01

    SDS-PAGE Gel
    QC Testing of H00000177-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 177
  • Gene Name:
  • AGER
  • Gene Alias:
  • MGC22357,RAGE
  • Gene Description:
  • advanced glycosylation end product-specific receptor
  • Gene Summary:
  • This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029155,OTTHUMP00000029156,advanced glycosylation end product-specific receptor RAGE3,advanced glycosylation end product-specific receptor variant sRAGE1,advanced glycosylation end product-specific receptor variant sRAGE2,receptor for advanced
  • RSS
  • YouTube
  • Linkedin
  • Facebook