AFP monoclonal antibody (M01J), clone 1G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
AFP monoclonal antibody (M01J), clone 1G7. Western Blot analysis of AFP expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody (M01J), clone 1G7.
Lane 1: AFP transfected lysate (Predicted MW: 68.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of AFP transfected lysate using anti-AFP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AFP MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AFP is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to AFP on HepG2 cell . [antibody concentration 30 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AFP.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
AFP (AAH27881.1, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (78)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AFP monoclonal antibody (M01J), clone 1G7. Western Blot analysis of AFP expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody (M01J), clone 1G7.
Lane 1: AFP transfected lysate (Predicted MW: 68.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of AFP transfected lysate using anti-AFP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AFP MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AFP is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to AFP on HepG2 cell . [antibody concentration 30 ug/ml] -
Gene Info — AFP
Entrez GeneID
174GeneBank Accession#
BC027881.1Protein Accession#
AAH27881.1Gene Name
AFP
Gene Alias
FETA, HPAFP
Gene Description
alpha-fetoprotein
Omim ID
104150Gene Ontology
HyperlinkGene Summary
This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. [provided by RefSeq
Other Designations
OTTHUMP00000160480|alpha-1-fetoprotein|alpha-fetoglobulin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com