Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP2B1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000163-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AP2B1 partial ORF ( NP_001273.1, 585 a.a. - 651 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.11
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000163-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 163
  • Gene Name:
  • AP2B1
  • Gene Alias:
  • ADTB2,AP105B,AP2-BETA,CLAPB1,DKFZp781K0743
  • Gene Description:
  • adaptor-related protein complex 2, beta 1 subunit
  • Gene Summary:
  • The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • adaptin, beta 2 (beta),clathrin assembly protein complex 2 beta large chain,clathrin-associated/assembly/adaptor protein, large, beta 1,plasma membrane adaptor HA2/AP2 adaptin beta subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook