AP2B1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AP2B1 partial ORF ( NP_001273.1, 585 a.a. - 651 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.11
Interspecies Antigen Sequence
Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AP2B1
Entrez GeneID
163GeneBank Accession#
NM_001282Protein Accession#
NP_001273.1Gene Name
AP2B1
Gene Alias
ADTB2, AP105B, AP2-BETA, CLAPB1, DKFZp781K0743
Gene Description
adaptor-related protein complex 2, beta 1 subunit
Omim ID
601025Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
adaptin, beta 2 (beta)|clathrin assembly protein complex 2 beta large chain|clathrin-associated/assembly/adaptor protein, large, beta 1|plasma membrane adaptor HA2/AP2 adaptin beta subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com