AP2B1 monoclonal antibody (M01J), clone 2D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AP2B1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
AP2B1 (NP_001273.1, 585 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AP2B1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AP2B1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — AP2B1
Entrez GeneID
163GeneBank Accession#
NM_001282Protein Accession#
NP_001273.1Gene Name
AP2B1
Gene Alias
ADTB2, AP105B, AP2-BETA, CLAPB1, DKFZp781K0743
Gene Description
adaptor-related protein complex 2, beta 1 subunit
Omim ID
601025Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
adaptin, beta 2 (beta)|clathrin assembly protein complex 2 beta large chain|clathrin-associated/assembly/adaptor protein, large, beta 1|plasma membrane adaptor HA2/AP2 adaptin beta subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com