Product Browser

Last updated: 2017/10/22
  • Related Product Showcase
  • By Research Area

  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP2A1 polyclonal antibody (A01)

  • Catalog # : H00000160-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AP2A1.
  • Immunogen:
  • AP2A1 (NP_055018, 824 a.a. ~ 923 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QVLNIECLRDFLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000160-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • AP2A1 polyclonal antibody (A01), Lot # 060111JC01 Western Blot analysis of AP2A1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 160
  • Gene Name:
  • AP2A1
  • Gene Alias:
  • ADTAA,AP2-ALPHA,CLAPA1
  • Gene Description:
  • adaptor-related protein complex 2, alpha 1 subunit
  • Gene Summary:
  • This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined. [provided by RefSeq
  • Other Designations:
  • 100 kDa coated vesicle protein A,adaptin, alpha A,clathrin-associated/assembly/adaptor protein, large, alpha 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook