ADH4 monoclonal antibody (M01), clone 3C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADH4.
Immunogen
ADH4 (NP_000661, 52 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (74)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ADH4 expression in transfected 293T cell line by ADH4 monoclonal antibody (M01), clone 3C5.
Lane 1: ADH4 transfected lysate(40.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADH4 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ADH4 over-expressed 293 cell line, cotransfected with ADH4 Validated Chimera RNAi ( Cat # H00000127-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ADH4 monoclonal antibody (M01), clone 3C5 (Cat # H00000127-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ADH4
Entrez GeneID
127GeneBank Accession#
NM_000670Protein Accession#
NP_000661Gene Name
ADH4
Gene Alias
ADH-2
Gene Description
alcohol dehydrogenase 4 (class II), pi polypeptide
Omim ID
103740Gene Ontology
HyperlinkGene Summary
This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. [provided by RefSeq
Other Designations
aldehyde reductase|class II alcohol dehydrogenase 4, pi subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com