Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADH1A (Human) Recombinant Protein (Q01)

  • Catalog # : H00000124-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADH1A partial ORF ( NP_000658, 298 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.32
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000124-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 124
  • Gene Name:
  • ADH1A
  • Gene Alias:
  • ADH1
  • Gene Description:
  • alcohol dehydrogenase 1A (class I), alpha polypeptide
  • Gene Summary:
  • This gene encodes class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. This gene is monomorphic and predominant in fetal and infant livers, whereas the genes encoding beta and gamma subunits are polymorphic and strongly expressed in adult livers. [provided by RefSeq
  • Other Designations:
  • ADH, alpha subunit,alcohol dehydrogenase 1 (class I), alpha polypeptide,aldehyde reductase,class I alcohol dehydrogenase, alpha subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook