ADH1A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ADH1A partial ORF ( NP_000658, 298 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.32
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ADH1A
Entrez GeneID
124GeneBank Accession#
NM_000667Protein Accession#
NP_000658Gene Name
ADH1A
Gene Alias
ADH1
Gene Description
alcohol dehydrogenase 1A (class I), alpha polypeptide
Omim ID
103700Gene Ontology
HyperlinkGene Summary
This gene encodes class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. This gene is monomorphic and predominant in fetal and infant livers, whereas the genes encoding beta and gamma subunits are polymorphic and strongly expressed in adult livers. [provided by RefSeq
Other Designations
ADH, alpha subunit|alcohol dehydrogenase 1 (class I), alpha polypeptide|aldehyde reductase|class I alcohol dehydrogenase, alpha subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
In vitro metabolism of a novel JNK inhibitor tanzisertib: interspecies differences in oxido-reduction and characterization of enzymes involved in metabolism.
Atsriku C, Hoffmann M, Moghaddam M, Kumar G, Surapaneni S.
Xenobiotica 2015 Jun; 45(6):465.
Application:Enzyme, Human, Tanzisertib were incubated in human liver microsomes, cytosol and hepatocytes.
-
ADH IB Expression, but Not ADH III, Is Decreased in Human Lung Cancer.
Mutka SC, Green LH, Verderber EL, Richards JP, Looker DL, Chlipala EA, Rosenthal GJ.
PLoS One 2012 Dec; 7(12):e52995.
Application:WB, Human, Recombinant proteins.
-
In vitro metabolism of a novel JNK inhibitor tanzisertib: interspecies differences in oxido-reduction and characterization of enzymes involved in metabolism.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com