ADD3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ADD3.
Immunogen
ADD3 (NP_058432, 462 a.a. ~ 560 a.a) partial recombinant protein with GST tag.
Sequence
PRTKITWMKAEDSSKVSGGTPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ADD3 polyclonal antibody (A01), Lot # CHI0060725QCS1 Western Blot analysis of ADD3 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
ADD3 polyclonal antibody (A01), Lot # CHI0060725QCS1. Western Blot analysis of ADD3 expression in PC-12.Western Blot (Cell lysate)
ADD3 polyclonal antibody (A01), Lot # CHI0060725QCS1. Western Blot analysis of ADD3 expression in NIH/3T3.Western Blot (Cell lysate)
ADD3 polyclonal antibody (A01), Lot # CHI0060725QCS1. Western Blot analysis of ADD3 expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — ADD3
Entrez GeneID
120GeneBank Accession#
NM_016824Protein Accession#
NP_058432Gene Name
ADD3
Gene Alias
ADDL
Gene Description
adducin 3 (gamma)
Omim ID
601568Gene Ontology
HyperlinkGene Summary
Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced adducin gamma transcripts encoding different isoforms have been described. The functions of the different isoforms are not known. [provided by RefSeq
Other Designations
OTTHUMP00000020463|OTTHUMP00000020464|adducin-like protein 70
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com