Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADARB1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000104-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADARB1 partial ORF ( AAH65545, 592 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000104-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 104
  • Gene Name:
  • ADARB1
  • Gene Alias:
  • ADAR2,ADAR2a,ADAR2a-L1,ADAR2a-L2,ADAR2a-L3,ADAR2b,ADAR2c,ADAR2d,ADAR2g,DRABA2,DRADA2,RED1
  • Gene Description:
  • adenosine deaminase, RNA-specific, B1 (RED1 homolog rat)
  • Gene Summary:
  • This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq
  • Other Designations:
  • ADAR2c ADAR2d,OTTHUMP00000115341,OTTHUMP00000115342,RNA editase,RNA editing deaminase 1,RNA-specific adenosine deaminase B1,adenosine deaminase acting on RNA type2a,adenosine deaminase acting on RNA type2d,adenosine deaminase acting on RNA type2g,adenosin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook