Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADAR (Human) Recombinant Protein (Q01)

  • Catalog # : H00000103-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADAR partial ORF ( NP_001102.2, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLGSQGLQRGFQH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000103-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 103
  • Gene Name:
  • ADAR
  • Gene Alias:
  • ADAR1,DRADA,DSH,DSRAD,G1P1,IFI-4,IFI4,K88dsRBP,p136
  • Gene Description:
  • adenosine deaminase, RNA-specific
  • Gene Summary:
  • This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • 136 kDa double-stranded RNA binding protein,OTTHUMP00000035372,OTTHUMP00000035373,adenosine deaminase acting on RNA 1-A,double-stranded RNA-specific adenosine deaminase,interferon-induced protein 4,interferon-inducible protein 4
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook