Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACTG2 polyclonal antibody (A01)

  • Catalog # : H00000072-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ACTG2.
  • Immunogen:
  • ACTG2 (NP_001606, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000072-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ACTG2 polyclonal antibody (A01), Lot # 051206JCO1 Western Blot analysis of ACTG2 expression in NIH/3T3 ( Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 72
  • Gene Name:
  • ACTG2
  • Gene Alias:
  • ACT,ACTA3,ACTE,ACTL3,ACTSG
  • Gene Description:
  • actin, gamma 2, smooth muscle, enteric
  • Gene Summary:
  • Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 2, encoded by this gene, is a smooth muscle actin found in enteric tissues. [provided by RefSeq
  • Other Designations:
  • actin, gamma 2,actin-like protein,alpha-actin 3,smooth muscle gamma actin
  • RSS
  • YouTube
  • Linkedin
  • Facebook