Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACO2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000050-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ACO2 partial ORF ( AAH14092, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.43
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000050-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 50
  • Gene Name:
  • ACO2
  • Gene Alias:
  • ACONM,MGC20605,MGC33908
  • Gene Description:
  • aconitase 2, mitochondrial
  • Gene Summary:
  • The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000042146,OTTHUMP00000165920,aconitase 2,aconitate hydratase,citrate hydro-lyase
  • RSS
  • YouTube
  • Linkedin
  • Facebook