ACO2 monoclonal antibody (M01), clone 1A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACO2.
Immunogen
ACO2 (AAH14092, 1 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — ACO2
Entrez GeneID
50GeneBank Accession#
BC014092Protein Accession#
AAH14092Gene Name
ACO2
Gene Alias
ACONM, MGC20605, MGC33908
Gene Description
aconitase 2, mitochondrial
Omim ID
100850Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. [provided by RefSeq
Other Designations
OTTHUMP00000042146|OTTHUMP00000165920|aconitase 2|aconitate hydratase|citrate hydro-lyase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glyoxylate and dicarboxylate metabolism
+ View More Disease
-
Publication Reference
-
Regulation of mitochondrial aconitase by phosphorylation in diabetic rat heart.
Lin G, Brownsey RW, MacLeod KM.
Cellular and Molecular Life Sciences 2009 Mar; 66(5):919.
Application:IP, WB-Ti, Rat, Rat hearts.
-
Regulation of mitochondrial aconitase by phosphorylation in diabetic rat heart.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com