Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACCN2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000041-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ACCN2 partial ORF ( NP_064423.2, 96 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.64
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000041-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 41
  • Gene Name:
  • ACCN2
  • Gene Alias:
  • ASIC,ASIC1,ASIC1A,BNaC2,hBNaC2
  • Gene Description:
  • amiloride-sensitive cation channel 2, neuronal
  • Gene Summary:
  • This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is expressed in most if not all brain neurons, and it may be an ion channel subunit; however, its function as an ion channel remains unknown. Alternative splicing of this gene generates 2 transcript products. [provided by RefSeq
  • Other Designations:
  • Cation channel, amiloride-sensitive, neuronal, 2,acid-sensing ion channel 1a protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook